PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0525s0080.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 262aa    MW: 27785.4 Da    PI: 6.587
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0525s0080.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.82.1e-372786362
                  zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                            ++ l+cprC+st tkfCyynny+lsqPr+fCk+CrryWt+GG+lr+vPvGgg+rkn k+s
  SapurV1A.0525s0080.1.p 27 TEPLPCPRCNSTTTKFCYYNNYNLSQPRHFCKSCRRYWTQGGTLRDVPVGGGTRKNSKRS 86
                            67899***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-232878IPR003851Zinc finger, Dof-type
PfamPF027011.6E-322984IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0593084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MPSEISQRHP TEAQNTMDTT HHPTKTTEPL PCPRCNSTTT KFCYYNNYNL SQPRHFCKSC  60
RRYWTQGGTL RDVPVGGGTR KNSKRSRSTS NNSPSMSTSS SNSTSSNSAT LTAFTTTHEP  120
ESMPVVLPST TDSGLAGVKT EVPAGLNLND GLPSEDGNFI SLMNSNDHHG FTGLGGYGYA  180
SGFGFGPSEM GIGFGGRGSW SCPVMENGLV NGGTSGCHPW QLECDHVEGG GLQAGFTTDT  240
ENYFGSWPDL VMSAPAGKGF N*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006375014.11e-164hypothetical protein POPTR_0014s03590g
TrEMBLB9MVJ01e-164B9MVJ0_POPTR; Uncharacterized protein
STRINGPOPTR_0014s03590.11e-164(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28013168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G47655.11e-33Dof family protein